- Recombinant Escherichia coli Inner membrane protein yiaB (yiaB)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1043991
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,555 Da
- E Coli or Yeast
- 1-113
- JW5654, ECK3552
- Inner membrane protein yiaB (yiaB)
Sequence
MKTSKTVAKLLFVVGALVYLVGLWISCPLLSGKGYFLGVLMTATFGNYAYLRAEKLGQLDDFFTHICQLVALITIGLLFIGVLNAPINTYEMVIYPIAFFVCLFGQMRLFRSA